PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00469.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 307aa    MW: 35358.9 Da    PI: 6.3791
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00469.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.31.1e-10175218548
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                              kr +r   NR +A+rsR RK+++i eLe+ v +L+ae + L  +
  Rsa1.0_00469.1_g00001.1 175 KRVKRILANRQSAQRSRVRKLQYITELERSVTSLQAEVSVLSPR 218
                              8999********************************98877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-12171235IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.588173236IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.6E-11175226No hitNo description
SuperFamilySSF579595.47E-11175229No hitNo description
PfamPF001703.7E-9175218IPR004827Basic-leucine zipper domain
CDDcd147032.72E-22176226No hitNo description
PROSITE patternPS000360178193IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MAQLPPKIPN MTPHWPDFSF QKLSSTAVQN PSWVDEFLDF SACRRGNHRR SISDSIAFLE  60
APFVRGHTRL ENQHFDRFDD EQFMSMFKDD DGLHHNNNNN NNNNLSRDNN NNELSSNTST  120
LSDHNSFNGD KEQPSDHNMK HNEEVYSQCK TEPEDGMASN NDSGNSSVNR IIDPKRVKRI  180
LANRQSAQRS RVRKLQYITE LERSVTSLQA EVSVLSPRVA FLDHQRLLLN VDNSSLKQRI  240
AALAQDKIFK DAHQEALKRE IERLREVYQQ QSLEKMENAN HSQVTGTRAN SDVDIKPSIE  300
QEELFNV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142832.11e-180PREDICTED: transcription factor RF2a
SwissprotF4IN231e-146BZP34_ARATH; Basic leucine zipper 34
TrEMBLM4CKF41e-180M4CKF4_BRARP; Uncharacterized protein
STRINGBra004689.1-P1e-179(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17532777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.21e-142bZIP family protein